Virtual 2D-PAGE plot for 1940 proteins (isoelectric point calculated using IPC2_protein)
Get csv file with sequences according to given criteria:
* You can choose from 21 different methods for calculating isoelectric point
Summary statistics related to proteome-wise predictions
Protein with the lowest isoelectric point:
>tr|A0A544QVQ9|A0A544QVQ9_9FIRM FAA hydrolase family protein OS=Peptacetobacter hominis OX=2743610 GN=EXD82_05080 PE=4 SV=1
MKVTVPETAVETLKSILEENQDKPNNIRVFFQGMGCAGPSFGLALDQLEESDLTHEVDGLNFIMSQEEFDAYGDIVIQDTGFGFKVVPESMVGESCDCNSGCSGCCS
Molecular weight: 11.55 kDa Isoelectric point according different methods:
Molecular weight: 5.55 kDa Isoelectric point according different methods:
Peptides (in silico digests for buttom-up proteomics)
Below you can find in silico digests of the whole proteome with Trypsin, Chymotrypsin, Trypsin+LysC, LysN, ArgC proteases suitable for different mass spec machines.